TMEM61 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A20151
Zusätzliche Namen:: TMEM61
Anwendung:: ELISA, WB
Molekulargewicht:: 24kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ASIPGPPRWDPYHLSRDLYYLTVESSEKESCRTPKVVDIPTYEEAVSFPVAEGPPTPPAYPTEEALEPSGSRDALLSTQPAWPPPSYESISLALDAVSAETTPSATRSCSGLVQTARGGS
Uniprot:: Q8N0U2
Synonyme:: transmembrane protein 61
Weitere Details:: Predicted to be integral component of membrane.