ANGPTL4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2011
Zusätzliche Namen:: ANGPTL4|ARP4|FIAF|HARP|HFARP|NL2|PGAR|pp1158|TGQTL|UNQ171
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 45-50kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQ
Uniprot:: Q9BY76
Synonyme:: Angiopoietin-like protein 4;angiopoietin-related protein 4;ARP4;fasting-induced adipose factor;FIAF;HARP;hepatic angiopoietin-related protein;hepatic fibrinogen/angiopoietin-related protein;HFARP;NL2;peroxisome proliferator-activated receptor (PPAR) gamma induced angiopoietin-related protein;PGAR;pp1158;PPARG angiopoietin related protein;TGQTL;UNQ171
Weitere Details:: This gene encodes a glycosylated, secreted protein containing a C-terminal fibrinogen domain. The encoded protein is induced by peroxisome proliferation activators and functions as a serum hormone that regulates glucose homeostasis, lipid metabolism, and insulin sensitivity. This protein can also act as an apoptosis survival factor for vascular endothelial cells and can prevent metastasis by inhibiting vascular growth and tumor cell invasion. The C-terminal domain may be proteolytically-cleaved from the full-length secreted protein. Decreased expression of this gene has been associated with type 2 diabetes. Alternative splicing results in multiple transcript variants. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4.

Versandbedingungen:: Blue Ice