SNRPB Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2009
Zusätzliche Namen:: CCMS|COD|Sm-B/B'|SmB/B'|SmB/SmB'|snRNP-B|SNRPB|SNRPB1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGA
Uniprot:: P14678
Synonyme:: B polypeptide of Sm protein;CCMS;COD;Sm protein B/B';Sm-B/B';sm-B/Sm-B';small nuclear ribonucleoprotein polypeptide B;small nuclear ribonucleoprotein polypeptides B and B';small nuclear ribonucleoprotein-associated proteins B and B';SmB/B';SmB/SmB';snRNP-B;SNRPB1
Weitere Details:: The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or snRNP structure. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding different isoforms (B and B') have been found for this gene.