A20020
HIF3A Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A20020
- Zusätzliche Namen:
- bHLHe17|HIF-3A|HIF3-alpha-1|HIF3A|IPAS|MOP7|PASD7
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 85kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MALGLQRARSTTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLTISYLRMHRLCAAGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLSQLELIGHSIF
- Uniprot:
- Q9Y2N7
- Synonyme:
- basic-helix-loop-helix-PAS protein MOP7;bHLHe17;class E basic helix-loop-helix protein 17;HIF-3A;HIF3-alpha-1;hypoxia inducible factor 3 alpha subunit;hypoxia-inducible factor 3-alpha;inhibitory PAS domain protein;IPAS;member of PAS protein 7;MOP7;PAS domain-containing protein 7;PASD7
- Weitere Details:
- The protein encoded by this gene is the alpha-3 subunit of one of several alpha/beta-subunit heterodimeric transcription factors that regulate many adaptive responses to low oxygen tension (hypoxia). The alpha-3 subunit lacks the transactivation domain found in factors containing either the alpha-1 or alpha-2 subunits. It is thought that factors containing the alpha-3 subunit are negative regulators of hypoxia-inducible gene expression. Multiple alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice