PLP1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A20009
Zusätzliche Namen:: GPM6C|HLD1|MMPL|PLP|PLP/DM20|PLP1|PMD|SPG2
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 20-25kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPD
Uniprot:: P60201
Synonyme:: GPM6C;HLD1;lipophilin;major myelin proteolipid protein;MMPL;myelin proteolipid protein;PLP;PLP/DM20;PMD;SPG2
Weitere Details:: This gene encodes a transmembrane proteolipid protein that is the predominant component of myelin. The encoded protein may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively splicing results in multiple transcript variants, including the DM20 splice variant.