AP2B1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1995
Zusätzliche Namen:: ADTB2|AP105B|AP2-BETA|AP2B1|CLAPB1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 105kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Uniprot:: P63010
Synonyme:: adapter-related protein complex 2 beta subunit;adapter-related protein complex 2 subunit beta;adaptin, beta 2 (beta);adaptor protein complex AP-2 subunit beta;adaptor related protein complex 2 beta 1 subunit;adaptor-related protein complex 2 subunit beta;ADTB2;AP-2 complex subunit beta;AP105B;AP2-BETA;beta-2-adaptin;beta-adaptin;beta2-adaptin;CLAPB1;clathrin assembly protein complex 2 beta large chain;clathrin-associated/assembly/adaptor protein, large, beta 1;plasma membrane adaptor HA2/AP2 adaptin beta subunit;testicular tissue protein Li 22
Weitere Details:: The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice