A1987
S100A10 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A1987
- Zusätzliche Namen:
- 42C|ANX2L|ANX2LG|Ca[1]|CAL1L|CLP11|GP11|p10|P11|S100A10
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 11kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
- Uniprot:
- P60903
- Synonyme:
- 42C;annexin II ligand, calpactin I, light polypeptide;annexin II tetramer (AIIt) p11 subunit;ANX2L;ANX2LG;Ca[1];CAL1L;calpactin I light chain;calpactin-1 light chain;cellular ligand of annexin II;CLP11;GP11;p10;p10 protein;P11;protein S100-A10;S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11));S100 calcium-binding protein A10
- Weitere Details:
- The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis.
- Versandbedingungen:
- Blue Ice








