A19813
Syntaxin Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19813
- Zusätzliche Namen:
- STX1A/STX1B/STX2/STX3|Syntaxin
- Anwendung:
- ELISA, WB, IHC-P, IF
- Molekulargewicht:
- 35 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIE
- Uniprot:
- P32856, P61266, Q13277, Q16623
- Synonyme:
- DIAR12;EPIM;epimorphin;EPM;GEFSP9;HPC-1;MVID2;neuron-specific antigen HPC-1;P35-1;RDMVID;STX1;STX1B1;STX1B2;STX2A;STX2B;STX2C;STX3A;SYN1A;syntaxin 1A (brain);syntaxin 3A;syntaxin 3B;syntaxin-1A;syntaxin-1B;syntaxin-1B1;syntaxin-1B2;syntaxin-2;syntaxin-3
- Weitere Details:
- The protein encoded by this gene belongs to a family of proteins thought to play a role in the exocytosis of synaptic vesicles. Vesicle exocytosis releases vesicular contents and is important to various cellular functions. For instance, the secretion of transmitters from neurons plays an important role in synaptic transmission. After exocytosis, the membrane and proteins from the vesicle are retrieved from the plasma membrane through the process of endocytosis. Mutations in this gene have been identified as one cause of fever-associated epilepsy syndromes. A possible link between this gene and Parkinson's disease has also been suggested. [provided by RefSeq, Jan 2015]
- Versandbedingungen:
- Blue Ice