A19808
BCL2L12 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19808
- Anwendung:
- ELISA, WB, IHC-P, IP
- Molekulargewicht:
- 32kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD
- Uniprot:
- Q9HB09
- Synonyme:
- Bcl-2 related proline-rich protein;bcl-2-like protein 12;Bcl-2-related proline-rich protein;BCL2-like 12 (proline rich)
- Weitere Details:
- This gene encodes a member of a family of proteins containing a Bcl-2 homology domain 2 (BH2). The encoded protein is an anti-apoptotic factor that acts as an inhibitor of caspases 3 and 7 in the cytoplasm. In the nucleus, it binds to the p53 tumor suppressor protein, preventing its association with target genes. Overexpression of this gene has been detected in a number of different cancers. There is a pseudogene for this gene on chromosome 3. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice