A19807
MAD3/MXD3 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19807
- Zusätzliche Namen:
- BHLHC13|MAD3|MAD3/MXD3|MYX
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 26kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RRARMHIQKLEDQEQRARQLKERLRSKQQSLQRQLEQLRGLAGAAERERLRADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGF
- Uniprot:
- Q9BW11
- Synonyme:
- BHLHC13;class C basic helix-loop-helix protein 13;MAD3;max dimerization protein 3;max dimerizer 3;Max-associated protein 3;Max-interacting transcriptional repressor MAD3;MYX
- Weitere Details:
- This gene encodes a member of the Myc superfamily of basic helix-loop-helix leucine zipper transcriptional regulators. The encoded protein forms a heterodimer with the cofactor MAX which binds specific E-box DNA motifs in the promoters of target genes and regulates their transcription. Disruption of the MAX-MXD3 complex is associated with uncontrolled cell proliferation and tumorigenesis. Transcript variants of this gene encoding different isoforms have been described.
- Versandbedingungen:
- Blue Ice