A19800
Neurogenin 2 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19800
- Zusätzliche Namen:
- Atoh4|bHLHa8|Math4A|Neurogenin 2|ngn-2|NGN2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 29kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GARRQRGAEAGQGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTK
- Uniprot:
- Q9H2A3
- Synonyme:
- Atoh4;bHLHa8;class A basic helix-loop-helix protein 8;Math4A;neurogenin-2;ngn-2;NGN2;protein atonal homolog 4
- Weitere Details:
- This gene encodes a neural-specific basic helix-loop-helix (bHLH) transcription factor that can specify a neuronal fate on ectodermal cells and is expressed in neural progenitor cells within the developing central and peripheral nervous systems. The protein product of this gene also plays a role in the differentiation and survival of midbrain dopaminergic neurons.
- Versandbedingungen:
- Blue Ice