A19798
VPS11 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19798
- Zusätzliche Namen:
- DYT32|END1|HLD12|hVPS11|PEP5|RNF108|VPS11
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 108kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAAYLQWRRFVFFDKELVKEPLSNDGAAPGATPASGSAASKFLCLPPGITVCDSGRGSLVFGDMEGQIWFLPRSLQLTGFQAYKLRVTHLYQLKQHNILA
- Uniprot:
- Q9H270
- Synonyme:
- END1;HLD12;hVPS11;PEP5;RING finger protein 108;RNF108;vacuolar protein sorting 11 homolog;vacuolar protein sorting-associated protein 11 homolog;VPS11, CORVET/HOPS core subunit
- Weitere Details:
- Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps11 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice