A19794
CDC40 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19794
- Zusätzliche Namen:
- CDC40|EHB3|PCH15|PRP17|PRPF17
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 75 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFR
- Uniprot:
- O60508
- Synonyme:
- cell division cycle 40 homolog;EH-binding protein 3;EHB3;hPRP17;PCH15;pre-mRNA splicing factor 17;pre-mRNA-processing factor 17;PRP17;PRP17 homolog;PRPF17
- Weitere Details:
- Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp17 protein, which functions in two different cellular processes: pre-mRNA splicing and cell cycle progression. It suggests that this protein may play a role in cell cycle progression.
- Versandbedingungen:
- Blue Ice