GOLPH4 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19790
Zusätzliche Namen:: GIMPC|GOLPH4|GPP130|P138
Anwendung:: ELISA, WB
Molekulargewicht:: 130kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYYELQTQLRKAEAVALKYQQHQESLSAQLQVVYEHRSRLEKSLQKERLEHKKAKEDFLVYKLEAQETL
Uniprot:: O00461
Synonyme:: 130 kDa golgi-localized phosphoprotein;cis Golgi-localized calcium-binding protein;GIMPC;Golgi integral membrane protein 4;golgi integral membrane protein, cis;golgi phosphoprotein 4;golgi phosphoprotein of 130 kDa;golgi-localized phosphoprotein of 130 kDa;GOLPH4;GPP130;P138;type II Golgi membrane protein
Weitere Details:: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus.