A19786
TC10/RHOQ Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19786
- Zusätzliche Namen:
- ARHQ|HEL-S-42|RASL7A|TC10|TC10/RHOQ|TC10A
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 23kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT
- Uniprot:
- P17081
- Synonyme:
- ARHQ;epididymis secretory protein Li 42;HEL-S-42;ras homolog gene family, member Q;ras-like protein family member 7A;ras-like protein TC10;RAS-like, family 7, member A;RASL7A;rho-related GTP-binding protein RhoQ;TC10;TC10A
- Weitere Details:
- This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The encoded protein is an important signalling protein for sarcomere assembly and has been shown to play a significant role in the exocytosis of the solute carrier family 2, facilitated glucose transporter member 4 and other proteins, possibly acting as the signal that turns on the membrane fusion machinery. Three related pseudogene have been identified on chromosomes 2 and 14.
- Versandbedingungen:
- Blue Ice