A19783
Pumilio 2 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19783
- Zusätzliche Namen:
- PUMH2|Pumilio 2|PUML2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 110-125kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAWGASHHSMSQPIMVQRRSGQGFHGNSEVNAILSPRSESGGLGVSMVEYVLS
- Uniprot:
- Q8TB72
- Synonyme:
- PUMH2;pumilio homolog 2;pumilio-2;PUML2
- Weitere Details:
- This gene encodes a protein that belongs to a family of RNA-binding proteins. The encoded protein functions as a translational repressor during embryonic development and cell differentiation. This protein is also thought to be a positive regulator of cell proliferation in adipose-derived stem cells. Alternate splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice