PHF8 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19780
Zusätzliche Namen:: JHDM1F|KDM7B|MRXSSD|PHF8|ZNF422
Anwendung:: ELISA, WB
Molekulargewicht:: 140kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDSLGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGT
Uniprot:: Q9UPP1
Synonyme:: [histone H3]-dimethyl-L-lysine(36) demethylase PHF8;[histone H3]-dimethyl-L-lysine(9) demethylase PHF8;histone lysine demethylase PHF8;JHDM1F;jumonji C domain-containing histone demethylase 1F;KDM7B;MRXSSD;PHD finger protein 8;ZNF422
Weitere Details:: The protein encoded by this gene is a histone lysine demethylase that preferentially acts on histones in the monomethyl or dimethyl states. The encoded protein requires Fe(2+) ion, 2-oxoglutarate, and oxygen for its catalytic activity. The protein has an N-terminal PHD finger and a central Jumonji C domain. This gene is thought to function as a transcription activator. Defects in this gene are a cause of syndromic X-linked Siderius type intellectual disability (MRXSSD) and over-expression of this gene is associated with several forms of cancer. Multiple transcript variants encoding different isoforms have been found for this gene.