A19765
WDR4 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19765
- Zusätzliche Namen:
- GAMOS6|hWH|MIGSB|TRM82|TRMT82|WDR4|Wuho
- Anwendung:
- ChIP, ELISA, WB, IHC-P
- Molekulargewicht:
- 49kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AFWCQENCVALLCDGTPVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGS
- Uniprot:
- P57081
- Synonyme:
- GAMOS6;hWH;MIGSB;protein Wuho homolog;TRM82;TRM82 tRNA methyltransferase 82 homolog;TRMT82;tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4;tRNA (guanine-N(7)-)-methyltransferase subunit WDR4;WD repeat-containing protein 4;Wuho
- Weitere Details:
- This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice