A19762
SRD5A2 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19762
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 28 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLLGLFCVHYFHRTFVYSL
- Uniprot:
- P31213
- Synonyme:
- 3-oxo-5-alpha-steroid 4-dehydrogenase 2;5 alpha-SR2;S5AR 2;SR type 2;Steroid 5-alpha-reductase 2;steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2);type II 5-alpha reductase
- Weitere Details:
- This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).
- Versandbedingungen:
- Blue Ice