alpha Sarcoglycan (SGCA) Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19754
Zusätzliche Namen:: 50DAG|adhalin|ADL|alpha Sarcoglycan (SGCA)|DAG2|DMDA2|LGMD2D|LGMDR3|SCARMD1
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 48kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VDALVTLLVPLLVALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAASREVPRPLSTLPMFNVHTGERLPPRVDSAQVPLILDQH
Uniprot:: Q16586
Synonyme:: 50 kDa dystrophin-associated glycoprotein;50DAG;50kD DAG;adhalin;ADL;alpha-sarcoglycan;alpha-SG;DAG2;DMDA2;dystroglycan-2;LGMD2D;LGMDR3;limb girdle muscular dystrophy 2D;sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein);SCARMD1
Weitere Details:: This gene encodes a component of the dystrophin-glycoprotein complex (DGC), which is critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Its expression is thought to be restricted to striated muscle. Mutations in this gene result in type 2D autosomal recessive limb-girdle muscular dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene.