RORB Beta Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19753
Zusätzliche Namen:: bA133M9.1|EIG15|NR1F2|ROR-BETA|RORB Beta|RZR-BETA|RZRB
Anwendung:: ELISA, WB
Molekulargewicht:: 53kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MCENQLKTKADATAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQ
Uniprot:: Q92753
Synonyme:: bA133M9.1;EIG15;NR1F2;nuclear receptor ROR-beta;nuclear receptor RZR-beta;nuclear receptor subfamily 1 group F member 2;RAR-related orphan receptor beta;retinoic acid-binding receptor beta;retinoid-related orphan receptor beta;Retinoid-related orphan receptor-beta;ROR-BETA;RZR-BETA;RZRB
Weitere Details:: The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It is a DNA-binding protein that can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, and to help regulate the expression of some genes involved in circadian rhythm.