A19745
PRKAR2B Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A19745
- Zusätzliche Namen:
- PRKAR2|PRKAR2B|RII-BETA
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 46kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
- Uniprot:
- P31323
- Synonyme:
- cAMP-dependent protein kinase type II-beta regulatory chain;cAMP-dependent protein kinase type II-beta regulatory subunit;H_RG363E19.2;PRKAR2;protein kinase, cAMP-dependent, regulatory subunit type II beta;protein kinase, cAMP-dependent, regulatory, type II, beta;RII-BETA;WUGSC:H_RG363E19.2
- Weitere Details:
- cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. This subunit has been shown to interact with and suppress the transcriptional activity of the cAMP responsive element binding protein 1 (CREB1) in activated T cells. Knockout studies in mice suggest that this subunit may play an important role in regulating energy balance and adiposity. The studies also suggest that this subunit may mediate the gene induction and cataleptic behavior induced by haloperidol.
- Versandbedingungen:
- Blue Ice





