A19739
MEKK2 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19739
- Zusätzliche Namen:
- MEKK2|MEKK2B
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 78kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFPRPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLD
- Uniprot:
- Q9Y2U5
- Synonyme:
- MAP/ERK kinase kinase 2;MAPK/ERK kinase kinase 2;MEK kinase 2;MEKK 2;MEKK2;MEKK2B;mitogen-activated protein kinase kinase kinase 2
- Weitere Details:
- The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase preferentially activates other kinases involved in the MAP kinase signaling pathway. This kinase has been shown to directly phosphorylate and activate Ikappa B kinases, and thus plays a role in NF-kappa B signaling pathway. This kinase has also been found to bind and activate protein kinase C-related kinase 2, which suggests its involvement in a regulated signaling process.
- Versandbedingungen:
- Blue Ice