PLC beta 3 (PLCB3) Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19738
Zusätzliche Namen:: PLC beta 3 (PLCB3)|SMDCD
Anwendung:: ELISA, WB
Molekulargewicht:: 150kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSIRRLEEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG
Uniprot:: Q01970
Synonyme:: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3;phosphoinositide phospholipase C-beta-3;Phospholipase C-beta-3;phospholipase C, beta 3 (phosphatidylinositol-specific);PLC beta 3;SMDCD
Weitere Details:: This gene encodes a member of the phosphoinositide phospholipase C beta enzyme family that catalyze the production of the secondary messengers diacylglycerol and inositol 1,4,5-triphosphate from phosphatidylinositol in G-protein-linked receptor-mediated signal transduction. Alternative splicing results in multiple transcript variants.