5HT7 Receptor Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19706
Zusätzliche Namen:: 5-HT7|5HT7 Receptor
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 54kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNC
Uniprot:: P34969
Synonyme:: 5-HT-7;5-HT-X;5-HT7;5-hydroxytryptamine (serotonin) receptor 7 (adenylate cyclase-coupled);5-hydroxytryptamine receptor 7;Serotonin receptor 7
Weitere Details:: The neurotransmitter, serotonin, is thought to play a role in various cognitive and behavioral functions. The serotonin receptor encoded by this gene belongs to the superfamily of G protein-coupled receptors and the gene is a candidate locus for involvement in autistic disorder and other neuropsychiatric disorders. Three splice variants have been identified which encode proteins that differ in the length of their carboxy terminal ends.