SMARCC2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1967
Zusätzliche Namen:: BAF170|CRACC2|CSS8|Rsc8|SMARCC2
Anwendung:: ELISA, WB
Molekulargewicht:: 162kDa/170kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAKWILDTDTFNE
Uniprot:: Q8TAQ2
Synonyme:: BAF170;BRG1-associated factor 170;chromatin remodeling complex BAF170 subunit;CRACC2;CSS8;mammalian chromatin remodeling complex BRG1-associated factor 170;Rsc8;SWI/SNF complex 170 kDa subunit;SWI/SNF complex subunit SMARCC2;SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 2;SWI3-like protein
Weitere Details:: The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and contains a predicted leucine zipper motif typical of many transcription factors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.