[KO Validated] SIRT1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19667
Zusätzliche Namen:: SIR2|SIR2alpha|SIR2L1|T1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 130kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: A synthetic peptide corresponding to a sequence within amino acids 648-747 of human SIRT1 (Q96EB6).
Formulierung:: Unmodified
Sequenz:: NRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS
Uniprot:: Q96EB6
Synonyme:: CANDF7;IMD31A;IMD31B;IMD31C;ISGF-3;NAD-dependent protein deacetylase sirtuin-1;NAD-dependent protein deacylase sirtuin-1;regulatory protein SIR2 homolog 1;signal transducer and activator of transcription 1-alpha/beta;signal transducer and activator of transcription 1, 91kD;signal transducer and activator of transcription 1, 91kDa;SIR2;SIR2-like protein 1;SIR2alpha;SIR2L1;sirtuin type 1;STAT91;transcription factor ISGF-3 components p91/p84
Weitere Details:: This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice