[KO Validated] DNMT3A Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19659
Zusätzliche Namen:: 3A|DNMT3A2|HESJAS|M.HsaIIIA|TBRS
Anwendung:: ELISA, WB
Molekulargewicht:: 130kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVL
Uniprot:: Q9Y6K1
Synonyme:: cysteine methyltransferase DNMT3A;DNA (cytosine-5-)-methyltransferase 3 alpha;DNA (cytosine-5)-methyltransferase 3A;DNA cytosine methyltransferase 3A2;DNA methyltransferase HsaIIIA;DNA MTase HsaIIIA;DNMT3A2;HESJAS;M.HsaIIIA;TBRS
Weitere Details:: CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated.