A19638
Raf1 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A19638
- Zusätzliche Namen:
- c-Raf|CMD1NN|CRAF|NS5|Raf-1|Raf1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 73 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFR
- Uniprot:
- P04049
- Synonyme:
- c-Raf;C-Raf proto-oncogene, serine/threonine kinase;CMD1NN;CRAF;NS5;Oncogene RAF1;proto-oncogene c-RAF;raf proto-oncogene serine/threonine protein kinase;RAF proto-oncogene serine/threonine-protein kinase;Raf-1;v-raf-1 murine leukemia viral oncogene homolog 1;v-raf-1 murine leukemia viral oncogene-like protein 1
- Weitere Details:
- This gene is the cellular homolog of viral raf gene (v-raf). The encoded protein is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. Once activated, the cellular RAF1 protein can phosphorylate to activate the dual specificity protein kinases MEK1 and MEK2, which in turn phosphorylate to activate the serine/threonine specific protein kinases, ERK1 and ERK2. Activated ERKs are pleiotropic effectors of cell physiology and play an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. Mutations in this gene are associated with Noonan syndrome 5 and LEOPARD syndrome 2.
- Versandbedingungen:
- Blue Ice


_IP_01.jpg)