A19628
ABL2 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A19628
- Zusätzliche Namen:
- ABL2|ABLL|ARG
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 128kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE
- Uniprot:
- P42684
- Synonyme:
- Abelson murine leukemia viral oncogene homolog 2;Abelson tyrosine-protein kinase 2;abelson-related gene protein;ABLL;ARG;c-abl oncogene 2, non-receptor tyrosine kinase;tyrosine-protein kinase ABL2;tyrosine-protein kinase ARG;v-abl Abelson murine leukemia viral oncogene homolog 2
- Weitere Details:
- This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinases. The protein is highly similar to the c-abl oncogene 1 protein, including the tyrosine kinase, SH2 and SH3 domains, and it plays a role in cytoskeletal rearrangements through its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ets variant 6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

