A19626
HDAC2 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A19626
- Zusätzliche Namen:
- HD2|HDAC2|KDAC2|RPD3|YAF1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGED
- Uniprot:
- Q92769
- Synonyme:
- HD2;histone deacetylase 2;KDAC2;RPD3;transcriptional regulator homolog RPD3;YAF1;YY1-associated factor 1
- Weitere Details:
- This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3 and H4). This protein forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus, it plays an important role in transcriptional regulation, cell cycle progression and developmental events. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice


