ABCF1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19621
Zusätzliche Namen:: ABC27|ABC50|ABCF1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 120kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GQKARVVFAELACREPDVLILDEPTNNLDIESIDALGEAINEYKGAVIVVSHDARLITETNCQLWVVEEQSVSQIDGDFEDYKREVLEALGEVMVSRPRE
Uniprot:: Q8NE71
Synonyme:: ABC27;ABC50;ATP-binding cassette 50;ATP-binding cassette 50 (TNF-alpha stimulated);ATP-binding cassette sub-family F member 1;ATP-binding cassette, sub-family F (GCN20), member 1;TNF-alpha-stimulated ABC protein;TNFalpha-inducible ATP-binding protein
Weitere Details:: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the GCN20 subfamily. Unlike other members of the superfamily, this protein lacks the transmembrane domains which are characteristic of most ABC transporters. This protein may be regulated by tumor necrosis factor-alpha and play a role in enhancement of protein synthesis and the inflammation process.