A19619
HRAS Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A19619
- Zusätzliche Namen:
- C-BAS/HAS|C-H-RAS|C-HA-RAS1|CTLO|H-RASIDX|HAMSV|HRAS|HRAS1|p21ras|RASH1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 21kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS
- Uniprot:
- P01112
- Synonyme:
- C-BAS/HAS;C-H-RAS;C-HA-RAS1;c-has/bas p21 protein;CTLO;GTP- and GDP-binding peptide B;GTPase HRas;H-Ras-1;H-RASIDX;Ha-Ras;Ha-Ras1 proto-oncoprotein;HAMSV;Harvey rat sarcoma viral oncogene homolog;Harvey rat sarcoma viral oncoprotein;HRAS1;p19 H-RasIDX protein;p21ras;Ras family small GTP binding protein H-Ras;RASH1;transformation gene: oncogene HAMSV;transforming protein p21;v-Ha-ras Harvey rat sarcoma viral oncogene homolog
- Weitere Details:
- This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, cognitive disability, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.
- Versandbedingungen:
- Blue Ice



