TACC3 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19617
Zusätzliche Namen:: ERIC-1|ERIC1|maskin|TACC3|Tacc4
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 140 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQK
Uniprot:: Q9Y6A5
Synonyme:: ERIC-1;ERIC1;maskin;Tacc4;transforming acidic coiled-coil-containing protein 3
Weitere Details:: TACC3, also known as ERIC 1, belongs to the TACC family. TACC family members TACC1, TACC2, and TACC3 map very closely to the corresponding FGFR1, FGFR2, FGFR3 genes on chromosomes 8, 10, and 4. Subsequently, since they are phylogenetically related, it is proposed that TACC and FGFR have similar roles in cell growth and differentiation. It plays a role in the microtubule-dependent coupling of the nucleus and the centrosome and involved in the processes that regulate centrosome-mediated interkinetic nuclear migration (INM) of neural progenitors.