A19613
EBI3 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19613
- Zusätzliche Namen:
- EBI3|IL-27B|IL27B|IL35B
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 31kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
- Uniprot:
- Q14213
- Synonyme:
- cytokine receptor;EBV-induced gene 3 protein;Epstein-Barr virus induced gene 3;epstein-Barr virus-induced gene 3 protein;IL-27 subunit beta;IL-27B;IL27 subunit;IL27B;IL35 subunit;IL35B;interleukin-27 subunit beta
- Weitere Details:
- This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells.
- Versandbedingungen:
- Blue Ice