Cleaved PARP1 p25 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19612
Zusätzliche Namen:: ADPRT|ADPRT 1|ADPRT1|ARTD1|Cleaved PARP1 p25|pADPRT-1|PARP|PARP-1|PARS|Poly-PARP|PPOL
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 25 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: A synthetic peptide corresponding to a sequence within amino acids 150-214 of human Cleaved PARP1 p25 (P09874).
Formulierung:: Unmodified
Sequenz:: QLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVD
Uniprot:: P09874
Synonyme:: ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase);ADP-ribosyltransferase diphtheria toxin-like 1;ADP-ribosyltransferase NAD(+);ADPRT;ADPRT 1;ADPRT1;ARTD1;DNA ADP-ribosyltransferase PARP1;NAD(+) ADP-ribosyltransferase 1;pADPRT-1;PARP;PARP-1;poly (ADP-ribose) polymerase family, member 1;poly [ADP-ribose] polymerase 1;poly(ADP-ribose) synthetase;poly(ADP-ribosyl)transferase;poly[ADP-ribose] synthase 1;PPOL;protein poly-ADP-ribosyltransferase PARP1
Weitere Details:: This gene encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes.

Versandbedingungen:: Blue Ice