A19607
[KD Validated] Vimentin Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A19607
- Zusätzliche Namen:
- CTRCT30|HEL113|in|VIM|Vimentin
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC, IP
- Molekulargewicht:
- 50-60 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE
- Uniprot:
- P08670
- Synonyme:
- epididymis secretory sperm binding protein;vimentin
- Weitere Details:
- This gene encodes a type III intermediate filament protein. Intermediate filaments, along with microtubules and actin microfilaments, make up the cytoskeleton. The encoded protein is responsible for maintaining cell shape and integrity of the cytoplasm, and stabilizing cytoskeletal interactions. This protein is involved in neuritogenesis and cholesterol transport and functions as an organizer of a number of other critical proteins involved in cell attachment, migration, and signaling. Bacterial and viral pathogens have been shown to attach to this protein on the host cell surface. Mutations in this gene are associated with congenital cataracts in human patients.
- Versandbedingungen:
- Blue Ice
![[KD Validated] Vimentin Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19607/A19607_1.jpg)
![[KD Validated] Vimentin Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19607/A19607_2.jpg)
![[KD Validated] Vimentin Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19607/A19607_3.jpg)
![[KD Validated] Vimentin Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19607/A19607_4.jpg)
![[KD Validated] Vimentin Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19607/A19607_5.jpg)
![[KD Validated] Vimentin Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19607/A19607_ARC0086S-MB1-07_Auto WB_01.jpg)
![[KD Validated] Vimentin Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19607/A19607_ARC0086S-MB1-07_Auto WB_02.jpg)
![[KD Validated] Vimentin Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19607/A19607_ARC0086-8_WB_01.jpg)
![[KD Validated] Vimentin Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19607/A19607_ARC0086-8_WB_02.jpg)