DROSHA Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19598
Zusätzliche Namen:: DROSHA|ETOHI2|HSA242976|RANSE3L|RN3|RNASE3L|RNASEN
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 159kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MMQGNTCHRMSFHPGRGCPRGRGGHGARPSAPSFRPQNLRLLHPQQPPVQYQYEPPSAPSTTFSNSPAPNFLPPRPDFVPFPPPMPPSAQGPLPPCPIRP
Uniprot:: Q9NRR4
Synonyme:: drosha, double-stranded RNA-specific endoribonuclease;ETOHI2;HSA242976;nuclear RNase III Drosha;p241;Protein Drosha;putative protein p241 which interacts with transcription factor Sp1;putative ribonuclease III;RANSE3L;ribonuclease 3;Ribonuclease III;ribonuclease type III, nuclear;RN3;RNase III;RNASE3L;RNASEN
Weitere Details:: This gene encodes a ribonuclease (RNase) III double-stranded RNA-specific ribonuclease and subunit of the microprocessor protein complex, which catalyzes the initial processing step of microRNA (miRNA) synthesis. The encoded protein cleaves the stem loop structure from the primary microRNA (pri-miRNA) in the nucleus, yielding the precursor miRNA (pre-miRNA), which is then exported to the cytoplasm for further processing. In a human cell line lacking a functional copy of this gene, canonical miRNA synthesis is reduced. Somatic mutations in this gene have been observed in human patients with kidney cancer.

Versandbedingungen:: Blue Ice