A19597
NFAT2 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19597
- Zusätzliche Namen:
- NF-ATC|NF-ATc1.2|NFAT2|NFATc
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 70-140kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS
- Uniprot:
- O95644
- Synonyme:
- NF-ATC;NF-ATc1.2;NFAT transcription complex cytosolic component;NFAT2;NFATc;nuclear factor of activated T-cells 'c';nuclear factor of activated T-cells, cytoplasmic 1;nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1
- Weitere Details:
- The product of this gene is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Different isoforms of this protein may regulate inducible expression of different cytokine genes.
- Versandbedingungen:
- Blue Ice