A19594
ATG3 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19594
- Zusätzliche Namen:
- APG3|APG3-LIKE|APG3L|ATG3|hApg3|PC3-96
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 40kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEE
- Uniprot:
- Q9NT62
- Synonyme:
- 2610016C12Rik;APG3;APG3 autophagy 3-like;APG3-LIKE;APG3L;ATG3 autophagy related 3 homolog;autophagy-related protein 3;hApg3;PC3-96;Protein PC3-96;ubiquitin-like-conjugating enzyme ATG3
- Weitere Details:
- This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice