A19581
SynGAP Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19581
- Zusätzliche Namen:
- MRD5|RASA1|RASA5|SYNGAP
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 140kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH
- Uniprot:
- Q96PV0
- Synonyme:
- MRD5;neuronal RasGAP;Ras GTPase-activating protein SynGAP;ras/Rap GTPase-activating protein SynGAP;RASA1;RASA5;synaptic Ras GTPase activating protein 1 homolog;synaptic Ras GTPase activating protein, 135kDa;Synaptic Ras GTPase-activating protein 1;SYNGAP
- Weitere Details:
- This gene encodes a Ras GTPase activating protein that is a member of the N-methyl-D-aspartate receptor complex. The N-terminal domain of the protein contains a Ras-GAP domain, a pleckstrin homology domain, and a C2 domain that may be involved in binding of calcium and phospholipids. The C-terminal domain consists of a ten histidine repeat region, serine and tyrosine phosphorylation sites, and a T/SXV motif required for postsynaptic scaffold protein interaction. The encoded protein negatively regulates Ras, Rap and alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor trafficking to the postsynaptic membrane to regulate synaptic plasticity and neuronal homeostasis. Allelic variants of this gene are associated with intellectual disability and autism spectrum disorder. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice