A1958
Histone H2B Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A1958
- Zusätzliche Namen:
- GL105|H2B|H2B-GL105|H2B.1|H2BE|H2BFQ|H2BGL105|H2BQ|HIST2H2BE|Histone H2B
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 17kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR
- Uniprot:
- P62807, Q16778
- Synonyme:
- dJ221C16.3;dJ221C16.6;dJ221C16.8;GL105;H2B;H2B histone family, member A;H2B histone family, member B;H2B histone family, member G;H2B histone family, member H;H2B histone family, member K;H2B histone family, member L;H2B histone family, member Q;H2B-GL105;H2B.1;H2B.1A;H2B.1B;H2B.h;H2B/a;H2B/b;H2B/g;H2B/h;H2B/k;H2B/l;H2BC10;H2BC4;H2BC6;H2BC7;H2BC8;H2BE;H2BFA;H2BFB;H2BFG;H2BFH;H2BFK;H2BFL;H2BFQ;H2BGL105;H2BQ;HIRA-interacting protein 2;HIRIP2;HIST1H2BC;HIST1H2BD;HIST1H2BE;HIST1H2BF;HIST1H2BG;HIST1H2BI;HIST2H2BE;histone 1, H2bc;histone 1, H2bd;histone 1, H2be;histone 1, H2bf;histone 1, H2bg;histone 1, H2bi;histone 2, H2be;histone cluster 1 H2B family member c;histone cluster 1 H2B family member d;histone cluster 1 H2B family member e;histone cluster 1 H2B family member f;histone cluster 1 H2B family member g;histone cluster 1 H2B family member i;histone cluster 1, H2bc;histone cluster 1, H2bd;histone cluster 1, H2be;histone cluster 1, H2bf;histone cluster 1, H2bg;histone cluster 1, H2bi;histone cluster 2 H2B family member e;histone cluster 2, H2be;Histone H2B type 1-C/E/F/G/I;histone H2B type 1-D;histone H2B type 2-E;histone H2B-GL105;Histone H2B.1 A;histone H2B.1 B;Histone H2B.a;histone H2B.b;Histone H2B.g;Histone H2B.h;Histone H2B.k;Histone H2B.l;histone H2B.q
- Weitere Details:
- Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-dependent histone that is a member of the histone H2B family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. The protein has antibacterial and antifungal antimicrobial activity.
- Versandbedingungen:
- Blue Ice