[KO Validated] SOD2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19576
Zusätzliche Namen:: D2|GC1|GClnc1|IPO-B|IPOB|Mn-SOD|MNSOD|MVCD6
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 22kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSI
Uniprot:: P04179
Synonyme:: epididymis secretory sperm binding protein;gastric cancer-associated lncRNA 1;GClnc1;indophenoloxidase B;IPO-B;IPOB;manganese-containing superoxide dismutase;mangano-superoxide dismutase;Mn superoxide dismutase;Mn-SOD;MNSOD;MVCD6;superoxide dismutase [Mn], mitochondrial;superoxide dismutase 2, mitochondrial
Weitere Details:: This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 1.

Versandbedingungen:: Blue Ice