A19530
Prohibitin Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19530
- Zusätzliche Namen:
- HEL-215|HEL-S-54e|PHB|Prohibitin
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 30kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVV
- Uniprot:
- P35232
- Synonyme:
- epididymis luminal protein 215;epididymis secretory sperm binding protein Li 54e;HEL-215;HEL-S-54e;PHB1;prohibitin
- Weitere Details:
- This gene is evolutionarily conserved, and its product is proposed to play a role in human cellular senescence and tumor suppression. Antiproliferative activity is reported to be localized to the 3' UTR, which is proposed to function as a trans-acting regulatory RNA. Several pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice