UBE2D1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1951
Zusätzliche Namen:: E2(17)KB1|SFT|UBC4/5|UBCH5|UBCH5A|UBE2D1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 14kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM
Uniprot:: P51668
Synonyme:: (E3-independent) E2 ubiquitin-conjugating enzyme D1;E2 ubiquitin-conjugating enzyme D1;E2(17)KB1;SFT;stimulator of Fe transport;UBC4/5;UBC4/5 homolog;UBCH5;UBCH5A;ubiquitin carrier protein D1;ubiquitin conjugating enzyme E2D 1;ubiquitin-conjugating enzyme E2 D1;ubiquitin-conjugating enzyme E2-17 kDa 1;ubiquitin-conjugating enzyme E2(17)KB 1;ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast);ubiquitin-protein ligase D1
Weitere Details:: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. Two transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice