A1947
Smad5 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A1947
- Zusätzliche Namen:
- DWFC|JV5-1|MADH5|Smad5
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 52kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS
- Uniprot:
- Q99717
- Synonyme:
- DWFC;JV5-1;MAD, mothers against decapentaplegic homolog 5;MADH5;mothers against decapentaplegic homolog 5;mothers against decapentaplegic, drosophila, homolog of, 5;SMA- and MAD-related protein 5;SMAD family member 5;SMAD, mothers against DPP homolog 5
- Weitere Details:
- The protein encoded by this gene is involved in the transforming growth factor beta signaling pathway that results in an inhibition of the proliferation of hematopoietic progenitor cells. The encoded protein is activated by bone morphogenetic proteins type 1 receptor kinase, and may be involved in cancer. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice