Glypican 3 (GPC3) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1946
Zusätzliche Namen:: DGSX|Glypican 3 (GPC3)|GTR2-2|MXR7|OCI-5|SDYS|SGB|SGBS|SGBS1
Anwendung:: ELISA, Flow Cytometry, WB
Molekulargewicht:: 66kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFLVH
Uniprot:: P51654
Synonyme:: DGSX;glypican proteoglycan 3;glypican-3;GTR2-2;heparan sulphate proteoglycan;intestinal protein OCI-5;MXR7;OCI-5;SDYS;secreted glypican-3;SGB;SGBS;SGBS1
Weitere Details:: Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The protein encoded by this gene can bind to and inhibit the dipeptidyl peptidase activity of CD26, and it can induce apoptosis in certain cell types. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome, also known as Simpson dysmorphia syndrome. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice