GRIK2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1939
Zusätzliche Namen:: EAA4|GLR6|GluK2|GLUK6|GLUR6|GRIK2|MRT6|NEDLAS
Anwendung:: ELISA, WB
Molekulargewicht:: 115kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
Uniprot:: Q13002
Synonyme:: bA487F5.1;EAA4;excitatory amino acid receptor 4;GLR6;GluK2;GluK2(alt_5'UTR);GLUK6;gluR-6;GLUR6;glutamate receptor 6;glutamate receptor form A;glutamate receptor form B;glutamate receptor form C;glutamate receptor form D;glutamate receptor form E;glutamate receptor ionotropic, kainate 2;MRT6;putative NMDtranscript(cassette_171nt)
Weitere Details:: Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing at multiple sites within the first and second transmembrane domains, which is thought to alter the structure and function of the receptor complex. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene. Mutations in this gene have been associated with autosomal recessive cognitive disability.

Versandbedingungen:: Blue Ice