PP2A-B56B Beta/PR61B Beta/PPP2R5B Rabbit polyclonal antibody

Größe

£152.00

SKU:: A19332
Zusätzliche Namen:: B56B|B56beta|PP2A-B56B Beta/PR61B Beta/PPP2R5B|PR61B
Anwendung:: ELISA, WB
Molekulargewicht:: 57kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AVFGTLYQVSKEHWNQTIVSLIYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTPQVAASGGQS
Uniprot:: Q15173
Synonyme:: B56B;B56beta;PP2A B subunit isoform B'-beta;PP2A B subunit isoform B56-beta;PP2A B subunit isoform PR61-beta;PP2A B subunit isoform R5-beta;PR61B;protein phosphatase 2 regulatory subunit B', beta;serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform
Weitere Details:: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a beta isoform of the regulatory subunit B56 subfamily.