PI4KA Rabbit polyclonal antibody

Größe

£152.00

SKU:: A19329
Zusätzliche Namen:: GIDID2|PI4K-ALPHA|pi4K230|PI4KA|PIK4CA|PMGYCHA|SPG84
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 237kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: PEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLRCRSDSEDECSTQEADGQKISWQAAIFKVGDDCRQDML
Uniprot:: P42356
Synonyme:: phosphatidylinositol 4-kinase 230;phosphatidylinositol 4-kinase alpha;phosphatidylinositol 4-kinase III alpha;phosphatidylinositol 4-kinase IIII+/-;phosphatidylinositol 4-kinase, catalytic, alpha;phosphatidylinositol 4-kinase, type III, alpha;PI4-kinase alpha;PI4K-ALPHA;pi4K230;PIK4CA;PMGYCHA;ptdIns-4-kinase alpha;testicular secretory protein Li 35
Weitere Details:: This gene encodes a phosphatidylinositol (PI) 4-kinase which catalyzes the first committed step in the biosynthesis of phosphatidylinositol 4,5-bisphosphate. The mammalian PI 4-kinases have been classified into two types, II and III, based on their molecular mass, and modulation by detergent and adenosine. The protein encoded by this gene is a type III enzyme that is not inhibited by adenosine. Alternative splicing results in multiple transcript variants encoding distinct isoforms.